PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_114.62
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 465aa    MW: 51283.8 Da    PI: 8.1149
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_114.62genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.6e-33194250360
                                   -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                          WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                   DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  evm.model.supercontig_114.62 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHPK 250
                                   9***************************************.***************85 PP

2WRKY105.72.4e-33390448159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver+++dp ++++tYeg+Hnh+
  evm.model.supercontig_114.62 390 LDDGFRWRKYGQKHVKGNPYPRSYYRCTSLKCNVRKHVERASDDPVAFITTYEGKHNHD 448
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-30179251IPR003657WRKY domain
PROSITE profilePS5081124.168187251IPR003657WRKY domain
SuperFamilySSF1182901.44E-26188251IPR003657WRKY domain
SMARTSM007743.2E-37192250IPR003657WRKY domain
PfamPF031061.1E-25194249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.3E-34376450IPR003657WRKY domain
SuperFamilySSF1182901.07E-28385450IPR003657WRKY domain
PROSITE profilePS5081134.911385450IPR003657WRKY domain
SMARTSM007741.9E-39390449IPR003657WRKY domain
PfamPF031062.9E-26391448IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEIKEAERVV IAKPVPSRPT CSSFRSFSEL LAGAINVSPF TTSSENTIAA IRPKTVRFKP  60
IVNHTPSRDN SSQADFSETA VCNLSVTKTD SKTNVLYKPQ AKLVSKATVS LLANMGNFST  120
NSHQVMQLAH ARAQNSNQDK HNFMSRFCSN MHQCIPSHTE AELTIGNSKT AAQNLEEDQK  180
TSSVVVSSDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE RSFDGQIAEI  240
VYKGEHNHPK PPPPKRSSSG TQGLVLASEG SAQDGNISLP NNQLNERTEG SEGRVENQNE  300
MGLSCFQGRY PPAYEPTAAG TIHVGTGNSE NSLGLSGECE EGSKVVEGDD DEPRSKRRKN  360
ENQSNEAGLL GESVQDPHVI VHGSTDSEIL DDGFRWRKYG QKHVKGNPYP RSYYRCTSLK  420
CNVRKHVERA SDDPVAFITT YEGKHNHDMP MRNTTNPVAS EPDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-31194450877Probable WRKY transcription factor 4
2lex_A2e-31194450877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381519.10.0hypothetical protein POPTR_0006s13550g
SwissprotQ9ZUU01e-118WRK44_ARATH; WRKY transcription factor 44
TrEMBLU5GAH70.0U5GAH7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s13550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Representative plantOGRP10259810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-115WRKY family protein